powered by:
Protein Alignment VARS1 and GstD5
DIOPT Version :9
Sequence 1: | XP_005249419.1 |
Gene: | VARS1 / 7407 |
HGNCID: | 12651 |
Length: | 1265 |
Species: | Homo sapiens |
Sequence 2: | NP_524914.3 |
Gene: | GstD5 / 48338 |
FlyBaseID: | FBgn0010041 |
Length: | 216 |
Species: | Drosophila melanogaster |
Alignment Length: | 52 |
Identity: | 15/52 - (28%) |
Similarity: | 27/52 - (51%) |
Gaps: | 7/52 - (13%) |
- Green bases have known domain annotations that are detailed below.
Human 142 LEEWLRLHTYLAGEAPTLADLAAVTAL--LLPFRYVLDPPARRIWNNVTRWF 191
|..:|....|:||:..|:||:|.::.: ...|.:.|:. :.||.||:
Fly 137 LNIFLEGQNYVAGDHLTVADIAILSTVSTFEIFDFDLNK-----YPNVARWY 183
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0625 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.