DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KDM6A and Tmtc4

DIOPT Version :10

Sequence 1:NP_001406738.1 Gene:KDM6A / 7403 HGNCID:12637 Length:1489 Species:Homo sapiens
Sequence 2:NP_650451.1 Gene:Tmtc4 / 41867 FlyBaseID:FBgn0038324 Length:705 Species:Drosophila melanogaster


Alignment Length:311 Identity:69/311 - (22%)
Similarity:116/311 - (37%) Gaps:73/311 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    72 LLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKNA-----A 131
            |....:.|...:|.:....|.|..||.|..:..|          |....|.::.:|:.|     .
  Fly   355 LPASGIICVGFVIAERTLYVPSIGFCLLSIYGFL----------YWYDSSTENTHWRTALRILLM 409

Human   132 FLYGLGLVYFHYNAFQW--AIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLAL 194
            .|:.:.:|.....|..|  ..:.|:..|.|.|.  .|| :|..:.   ::.||..::.|.||   
  Fly   410 LLFSVMMVRTRQRATDWLNEEQLFKSALQVCPD--NAK-VHYNIA---RLATDMGNNTKAFQ--- 465

Human   195 VDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLSAQVKATVLQQLG--WMHHTVD 257
                                     .||.|.|.|...           .:.|..||  :..|   
  Fly   466 -------------------------HYHRAIELYPNY-----------ESALMNLGNLYREH--- 491

Human   258 LLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWC 322
              |..:|.|    :|::.:|:|.|....:|..||...|:.||...|..||.:::......|..:.
  Fly   492 --GQLSTAE----EYIRLALQAYPAFPAAWMNLGIVQSAQGKYDKALASYEKALKYRANFAVCYY 550

Human   323 SIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIK 373
            ::|.||.:|.:..:||..:..||.|:.....||.::.|:.::.....||::
  Fly   551 NMGNLYLEQKRYAEALHHWQHAVALNPRQPKAWANILTMLDNKGLQDDALR 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KDM6ANP_001406738.1 TPR repeat 93..121 CDD:276809 6/27 (22%)
BepA 98..233 CDD:443813 27/141 (19%)
TPR repeat 129..159 CDD:276809 7/36 (19%)
TPR repeat 164..194 CDD:276809 8/29 (28%)
LapB 171..443 CDD:442196 45/205 (22%)
TPR repeat 205..233 CDD:276809 5/27 (19%)
TPR repeat 243..278 CDD:276809 8/36 (22%)
TPR repeat 285..312 CDD:276809 9/26 (35%)
TPR repeat 317..347 CDD:276809 9/29 (31%)
TPR repeat 352..378 CDD:276809 5/22 (23%)
JmjC 1151..1215 CDD:214721
JmjC 1185..1293 CDD:396791
Tmtc4NP_650451.1 TMTC_DUF1736 258..331 CDD:462468
LapB 431..675 CDD:442196 52/225 (23%)
TPR repeat 444..472 CDD:276809 11/59 (19%)
TPR repeat 480..506 CDD:276809 8/34 (24%)
TPR repeat 511..541 CDD:276809 9/29 (31%)
TPR repeat 546..574 CDD:276809 8/27 (30%)
TPR repeat 580..608 CDD:276809 5/22 (23%)
TPR repeat 614..642 CDD:276809
TPR repeat 647..677 CDD:276809
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.