DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment USF2 and Usf

DIOPT Version :9

Sequence 1:XP_024307452.1 Gene:USF2 / 7392 HGNCID:12594 Length:397 Species:Homo sapiens
Sequence 2:NP_572167.3 Gene:Usf / 31384 FlyBaseID:FBgn0029711 Length:437 Species:Drosophila melanogaster


Alignment Length:366 Identity:87/366 - (23%)
Similarity:142/366 - (38%) Gaps:109/366 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    95 TAGAVSVVSTAAFAGGQQAVTQVGVDG-----------------------------AAQRPG--- 127
            ||.....:..::||.|||::......|                             ..|.||   
  Fly    50 TADLSEALVHSSFANGQQSLILTSDTGNPLMNSQGAQIFLTICGDENSDDSQEYYTIKQEPGCDL 114

Human   128 ------PAAASVPPGPAAP--FPLAVIQNPFSNGGSPAAEA-------------------VSGEA 165
                  |:...:|.....|  ..:.:::...|..|.|..:|                   .|...
  Fly   115 DIHSLLPSNLQLPNNLQLPTGCEIYLVKETGSLMGEPPTKAAIKLELDTLSEKPLLPSVTTSSST 179

Human   166 RFAYFPASSV--------GDTTAVSVQTTDQSLQAG--------GQFYVMMTPQDVLQTGTQRTI 214
            :.|...|.:|        ..||:.:..||..|:..|        |..:.        |..:|...
  Fly   180 QSAVITAQTVNPPIPGNINTTTSTTSTTTTTSVLYGSHGNGHGHGHAHA--------QARSQPES 236

Human   215 APRTHPYSPKIDGTRTPRDERRRAQHNEVERRRRDKINNWIVQLSKIIPDCNADNSKTGAVSTPD 279
            |.:|.  |.|::..: .||::|||.|||||||||||||:||.:|.:::|..::.:|.:.|.::|.
  Fly   237 AGQTP--SSKLEAYK-KRDDKRRATHNEVERRRRDKINSWIFKLKEMLPSLSSSSSFSEASTSPS 298

Human   280 PQCLRWSRPPTLACRKSNSHGARESSLGWRPVGGACPKAPGPLAPQSKGGILSKACDYIRELRQT 344
                  :...|.....|:|.|...||.|..|..            .||..||.|||:||:.::..
  Fly   299 ------TSGSTSTNGSSHSKGNASSSSGRAPPN------------DSKSQILIKACEYIKSMQGE 345

Human   345 NQRMQETFKEAERLQMDNELLRQQIEELKNENALLRAQLQQ 385
            ...:::..:|.:.|:..|:.||::::.||.:.     |||:
  Fly   346 IDTLRDCLRETDSLRASNQALREELDRLKRQQ-----QLQE 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
USF2XP_024307452.1 HLH 233..346 CDD:238036 41/112 (37%)
ZapB 341..>385 CDD:310531 9/43 (21%)
UsfNP_572167.3 HLH 255..343 CDD:278439 40/105 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11470
eggNOG 1 0.900 - - E1_KOG1318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5213
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002665
OrthoInspector 1 1.000 - - otm40909
orthoMCL 1 0.900 - - OOG6_108108
Panther 1 1.100 - - O PTHR46117
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 1 1.000 - - X2414
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.850

Return to query results.
Submit another query.