DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment USF1 and CBF1

DIOPT Version :9

Sequence 1:NP_001263302.1 Gene:USF1 / 7391 HGNCID:12593 Length:310 Species:Homo sapiens
Sequence 2:NP_012594.1 Gene:CBF1 / 853523 SGDID:S000003821 Length:351 Species:Saccharomyces cerevisiae


Alignment Length:295 Identity:77/295 - (26%)
Similarity:118/295 - (40%) Gaps:76/295 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    67 SEGQLDGQTEGTGA-ISGYPATQSMTQAVI------QGAFTSDDAVDTEGTAAETHYTYFPSTAV 124
            ::|.:|......|| :.|   |||..::.:      :|:...|.:|.....||..:||   ....
Yeast    49 NDGNIDSALLSEGATLKG---TQSQYESGLTSNKDEKGSDDEDASVAEAAVAATVNYT---DLIQ 107

Human   125 G--DGAGGTTSGSTAAVVTTQGSEALLGQ--ATP------PGTGQFFVMMSPQEVLQGGSQRSIA 179
            |  |.:...||..|.|  ..:..::|.|:  .||      |.|....:..||.|..|......:.
Yeast   108 GQEDSSDAHTSNQTNA--NGEHKDSLNGERAITPSNEGVKPNTSLEGMTSSPMESTQQSKNDMLI 170

Human   180 P-RTHPYSP--------------------------KSEAPRT--TRDE---KRRAQHNEVERRRR 212
            | ..|...|                          :...|.|  |.||   :|:..|.|||||||
Yeast   171 PLAEHDRGPEHQQDDEDNDDADIDLKKDISMQPGRRGRKPTTLATTDEWKKQRKDSHKEVERRRR 235

Human   213 DKINNWIVQLSKIIPDCSMESTKSGQSKGGILSKACDYIQELRQSNHR----------LSEELQG 267
            :.||..|..||.::|  ..||     ||..||:.|.:|||:|::::..          |||  |.
Yeast   236 ENINTAINVLSDLLP--VRES-----SKAAILACAAEYIQKLKETDEANIEKWTLQKLLSE--QN 291

Human   268 LDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHGLE 302
            ..||...|:.|::::.:...:...::..||..|:|
Yeast   292 ASQLASANEKLQEELGNAYKEIEYMKRVLRKEGIE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
USF1NP_001263302.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..209 13/69 (19%)
bHLHzip_USF1 196..260 CDD:381494 28/66 (42%)
Leucine-zipper 271..292 3/20 (15%)
CBF1NP_012594.1 HLH 220..272 CDD:238036 26/58 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.878984 Normalized mean entropy S4388
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002665
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.