DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment USF1 and Usf

DIOPT Version :9

Sequence 1:NP_001263302.1 Gene:USF1 / 7391 HGNCID:12593 Length:310 Species:Homo sapiens
Sequence 2:NP_572167.3 Gene:Usf / 31384 FlyBaseID:FBgn0029711 Length:437 Species:Drosophila melanogaster


Alignment Length:352 Identity:91/352 - (25%)
Similarity:139/352 - (39%) Gaps:76/352 - (21%)


- Green bases have known domain annotations that are detailed below.


Human     7 TAETEEGTVQI-----QEGAVATGEDPTSVAIASIQSAATF---------PDPNVKYVFRTENGG 57
            ||:..|..|..     |:..:.|.:  |...:.:.|.|..|         .|....|..:.|.|.
  Fly    50 TADLSEALVHSSFANGQQSLILTSD--TGNPLMNSQGAQIFLTICGDENSDDSQEYYTIKQEPGC 112

Human    58 QVMYRVIQVSEGQLDGQ-----------TEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTA 111
            .:....:..|..||...           .:.||::.|.|.|::..:..:. ..:....:.:..|:
  Fly   113 DLDIHSLLPSNLQLPNNLQLPTGCEIYLVKETGSLMGEPPTKAAIKLELD-TLSEKPLLPSVTTS 176

Human   112 AETHYTYFPSTAVGDGAGGTTSGSTAAVVTTQGSEALLG-QATPPGTGQFFVMMSPQEVLQGGSQ 175
            :.|......:..|.....|..:.:|:...||..:..|.| .....|.|....        |..||
  Fly   177 SSTQSAVITAQTVNPPIPGNINTTTSTTSTTTTTSVLYGSHGNGHGHGHAHA--------QARSQ 233

Human   176 RSIAPRTHPYSPKSEAPRTTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSME-------- 232
            ...|.:|.  |.|.||.: .||:||||.|||||||||||||:||.:|.:::|..|..        
  Fly   234 PESAGQTP--SSKLEAYK-KRDDKRRATHNEVERRRRDKINSWIFKLKEMLPSLSSSSSFSEAST 295

Human   233 --------------------STKSGQ-----SKGGILSKACDYIQELRQSNHRLSEELQGLDQLQ 272
                                |:.||:     ||..||.|||:||:.::.....|.:.|:..|.|:
  Fly   296 SPSTSGSTSTNGSSHSKGNASSSSGRAPPNDSKSQILIKACEYIKSMQGEIDTLRDCLRETDSLR 360

Human   273 LDNDVLRQQVEDLKNKNLLLRAQLRHH 299
            ..|..||::::.||.:..|   |.|.|
  Fly   361 ASNQALREELDRLKRQQQL---QERFH 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
USF1NP_001263302.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 6/23 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..209 19/37 (51%)
bHLHzip_USF1 196..260 CDD:381494 36/96 (38%)
Leucine-zipper 271..292 6/20 (30%)
UsfNP_572167.3 HLH 255..343 CDD:278439 33/87 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11470
eggNOG 1 0.900 - - E1_KOG1318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5213
Isobase 1 0.950 - 0.878984 Normalized mean entropy S4388
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002665
OrthoInspector 1 1.000 - - otm40909
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46117
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2414
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.