DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment USF1 and usf1

DIOPT Version :9

Sequence 1:NP_001263302.1 Gene:USF1 / 7391 HGNCID:12593 Length:310 Species:Homo sapiens
Sequence 2:NP_001096236.1 Gene:usf1 / 100124791 XenbaseID:XB-GENE-5918718 Length:309 Species:Xenopus tropicalis


Alignment Length:310 Identity:261/310 - (84%)
Similarity:282/310 - (90%) Gaps:3/310 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGG-QVMYRVI 64
            ||||||.||.|||:|::|||||||||||||||||||||||||.||:||||||||||| |||||||
 Frog     1 MKGQQKVAEIEEGSVRVQEGAVATGEDPTSVAIASIQSAATFSDPSVKYVFRTENGGAQVMYRVI 65

Human    65 QVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFPSTAVGDGAG 129
            ||:||||||||||||||||:||||||||||||||||||||.:|:.:.||||||||| |||.| :.
 Frog    66 QVAEGQLDGQTEGTGAISGFPATQSMTQAVIQGAFTSDDAGETDASGAETHYTYFP-TAVTD-SN 128

Human   130 GTTSGSTAAVVTTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAPRT 194
            .:..||.|.|||.|.|:||||||...||||||||||.|:|||||||||||||||||||||:.||.
 Frog   129 SSVGGSAATVVTAQNSDALLGQAGSAGTGQFFVMMSSQDVLQGGSQRSIAPRTHPYSPKSDGPRA 193

Human   195 TRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSKGGILSKACDYIQELRQSNH 259
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.
 Frog   194 TRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSKGGILSKACDYIQELRQSNL 258

Human   260 RLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHGLEVVIKNDS 309
            |.|||||.|||||:||:||||||||||||||:||.||||||:|::||:||
 Frog   259 RHSEELQNLDQLQMDNEVLRQQVEDLKNKNLILRTQLRHHGVEIIIKSDS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
USF1NP_001263302.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 19/24 (79%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..209 34/37 (92%)
bHLHzip_USF1 196..260 CDD:381494 63/63 (100%)
Leucine-zipper 271..292 18/20 (90%)
usf1NP_001096236.1 HLH 199..254 CDD:306515 54/54 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 282 1.000 Domainoid score I10134
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002665
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2414
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.