DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rhox13 and Drgx

DIOPT Version :9

Sequence 1:NP_001171931.1 Gene:Rhox13 / 73614 MGIID:1920864 Length:232 Species:Mus musculus
Sequence 2:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster


Alignment Length:96 Identity:41/96 - (42%)
Similarity:54/96 - (56%) Gaps:7/96 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse   120 PPTVPAA----AAIQIPGPYRYRP---PRRHVRRRRRGPPFHFAQWQVEEMESLFEETQYPDLLT 177
            ||.:|..    ||......|.|.|   ....|||::|.....|...|:||:|:.|.:|.|||:.|
  Fly    17 PPRLPTLDYPFAATHPYTSYSYHPAIHDETFVRRKQRRNRTTFTLQQLEELETAFAQTHYPDVFT 81

Mouse   178 RGELARTLNVPEVKVKVWFTNRRAKQRKIER 208
            |.:||..:|:.|.:|:|||.|||||.||.||
  Fly    82 REDLAMKINLTEARVQVWFQNRRAKWRKAER 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rhox13NP_001171931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..114
Homeobox 155..204 CDD:278475 25/48 (52%)
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 25/51 (49%)
OAR 428..445 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.