DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42259 and spi-4

DIOPT Version :10

Sequence 1:NP_001036256.2 Gene:CG42259 / 7354475 FlyBaseID:FBgn0266569 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001076745.1 Gene:spi-4 / 4927055 WormBaseID:WBGene00044921 Length:80 Species:Caenorhabditis elegans


Alignment Length:81 Identity:23/81 - (28%)
Similarity:34/81 - (41%) Gaps:9/81 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YLFLIGGCCLVFAVSAQIPITPRRCPANETFLACGPDCQTECATLGKPCLVRHIRCPDGCYCNKG 70
            :||.:    ||.| :....:...:|..||.|..||..|...|......|:.   .|...|.|.:|
 Worm     4 FLFSL----LVLA-TLSFALAKNQCGENEIFNDCGSPCDRTCENPNPMCIQ---MCKARCECKQG 60

  Fly    71 FARNA-AGTCIPLRRC 85
            |..:: ...||.|::|
 Worm    61 FVVDSNTKKCIDLKKC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42259NP_001036256.2 TIL 30..85 CDD:460351 17/55 (31%)
spi-4NP_001076745.1 TIL 23..76 CDD:410995 17/55 (31%)

Return to query results.
Submit another query.