powered by:
Protein Alignment CG42259 and CG5267
DIOPT Version :9
Sequence 1: | NP_001036256.2 |
Gene: | CG42259 / 7354475 |
FlyBaseID: | FBgn0266569 |
Length: | 92 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611154.2 |
Gene: | CG5267 / 36875 |
FlyBaseID: | FBgn0034154 |
Length: | 201 |
Species: | Drosophila melanogaster |
Alignment Length: | 60 |
Identity: | 17/60 - (28%) |
Similarity: | 24/60 - (40%) |
Gaps: | 4/60 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 CPANETFLACGPDCQTECATLGKPCLVRHIRCPDGCYCNKGFARNAAGTCIPLRR-CNEG 88
|..|.|::.|...|...|....|.|:. .|...|.|.:|:..|...:...||. |.:|
Fly 132 CCHNSTYVGCAGVCPETCEYRSKYCVP---LCGPPCRCKRGYVYNIPHSACTLRSDCPKG 188
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42259 | NP_001036256.2 |
TIL |
30..85 |
CDD:280072 |
15/55 (27%) |
CG5267 | NP_611154.2 |
TIL |
132..185 |
CDD:334697 |
15/55 (27%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1625853at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.