powered by:
Protein Alignment CG42259 and CG33259
DIOPT Version :9
Sequence 1: | NP_001036256.2 |
Gene: | CG42259 / 7354475 |
FlyBaseID: | FBgn0266569 |
Length: | 92 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_996090.1 |
Gene: | CG33259 / 2768950 |
FlyBaseID: | FBgn0036495 |
Length: | 119 |
Species: | Drosophila melanogaster |
Alignment Length: | 46 |
Identity: | 16/46 - (34%) |
Similarity: | 18/46 - (39%) |
Gaps: | 4/46 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 CPANETFLACGPDCQTECATLGKP-CLVRHIRCPDGCYCNKGFARN 74
|..|.|...|...|...|.|.||| |. :.|...|.|..|:..|
Fly 27 CSVNGTQTDCPTACPETCDTKGKPNCT---LICGGPCVCKPGYVVN 69
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42259 | NP_001036256.2 |
TIL |
30..85 |
CDD:280072 |
16/46 (35%) |
CG33259 | NP_996090.1 |
TIL |
27..81 |
CDD:280072 |
16/46 (35%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1625853at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.