DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42259 and swm-1

DIOPT Version :9

Sequence 1:NP_001036256.2 Gene:CG42259 / 7354475 FlyBaseID:FBgn0266569 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_505346.1 Gene:swm-1 / 182893 WormBaseID:WBGene00023417 Length:135 Species:Caenorhabditis elegans


Alignment Length:74 Identity:22/74 - (29%)
Similarity:35/74 - (47%) Gaps:7/74 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CLVFAVSAQIPITPRRCPANETFLACGPDCQTECATLGKPCLVRHIRCPDGCYCNKGFARNAAGT 78
            |:|...:|     .:.|.|||..::|...|:.:|....|.|..:.|.  :.|.|..||.||:.|.
 Worm     9 CIVAVATA-----TKTCEANEELVSCHNTCEPQCGYTPKACTEQCIM--NTCDCKDGFVRNSLGK 66

  Fly    79 CIPLRRCNE 87
            |:.:..|.:
 Worm    67 CVEVSECTK 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42259NP_001036256.2 TIL 30..85 CDD:280072 18/54 (33%)
swm-1NP_505346.1 TIL 20..73 CDD:366828 18/54 (33%)
TIL 80..133 CDD:366828
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I7754
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4073
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1625853at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_110108
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X701
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.