powered by:
Protein Alignment CG42259 and C25E10.7
DIOPT Version :9
Sequence 1: | NP_001036256.2 |
Gene: | CG42259 / 7354475 |
FlyBaseID: | FBgn0266569 |
Length: | 92 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_505344.2 |
Gene: | C25E10.7 / 182891 |
WormBaseID: | WBGene00016096 |
Length: | 157 |
Species: | Caenorhabditis elegans |
Alignment Length: | 63 |
Identity: | 21/63 - (33%) |
Similarity: | 29/63 - (46%) |
Gaps: | 5/63 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 PITPRRCPANETFLACGPDCQTECATLGKPCLVRHIRC-PDGCYCNKGFARNAAGTCIPLRRC 85
|..| .|..|:..:|||.||:.:| |....|..:.| |:.|.|..|:.||....|:....|
Worm 25 PFLP-ECGKNQKRVACGYDCEPQC---GFDPTVCSLECKPNACVCKDGYVRNTKNDCVRRLEC 83
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42259 | NP_001036256.2 |
TIL |
30..85 |
CDD:280072 |
18/55 (33%) |
C25E10.7 | NP_505344.2 |
TIL |
30..83 |
CDD:280072 |
18/55 (33%) |
TIL |
90..144 |
CDD:280072 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
51 |
1.000 |
Domainoid score |
I7754 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
54 |
1.000 |
Inparanoid score |
I4073 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1625853at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_110108 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X701 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
6 | 5.870 |
|
Return to query results.
Submit another query.