DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42259 and C25E10.7

DIOPT Version :9

Sequence 1:NP_001036256.2 Gene:CG42259 / 7354475 FlyBaseID:FBgn0266569 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_505344.2 Gene:C25E10.7 / 182891 WormBaseID:WBGene00016096 Length:157 Species:Caenorhabditis elegans


Alignment Length:63 Identity:21/63 - (33%)
Similarity:29/63 - (46%) Gaps:5/63 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PITPRRCPANETFLACGPDCQTECATLGKPCLVRHIRC-PDGCYCNKGFARNAAGTCIPLRRC 85
            |..| .|..|:..:|||.||:.:|   |....|..:.| |:.|.|..|:.||....|:....|
 Worm    25 PFLP-ECGKNQKRVACGYDCEPQC---GFDPTVCSLECKPNACVCKDGYVRNTKNDCVRRLEC 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42259NP_001036256.2 TIL 30..85 CDD:280072 18/55 (33%)
C25E10.7NP_505344.2 TIL 30..83 CDD:280072 18/55 (33%)
TIL 90..144 CDD:280072
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I7754
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4073
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1625853at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_110108
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X701
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.