DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42259 and spi-3

DIOPT Version :10

Sequence 1:NP_001036256.2 Gene:CG42259 / 7354475 FlyBaseID:FBgn0266569 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_505344.2 Gene:spi-3 / 182891 WormBaseID:WBGene00016096 Length:157 Species:Caenorhabditis elegans


Alignment Length:63 Identity:21/63 - (33%)
Similarity:29/63 - (46%) Gaps:5/63 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PITPRRCPANETFLACGPDCQTECATLGKPCLVRHIRC-PDGCYCNKGFARNAAGTCIPLRRC 85
            |..| .|..|:..:|||.||:.:|   |....|..:.| |:.|.|..|:.||....|:....|
 Worm    25 PFLP-ECGKNQKRVACGYDCEPQC---GFDPTVCSLECKPNACVCKDGYVRNTKNDCVRRLEC 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42259NP_001036256.2 TIL 30..85 CDD:460351 18/55 (33%)
spi-3NP_505344.2 TIL 30..83 CDD:460351 18/55 (33%)
TIL 90..144 CDD:460351
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.