powered by:
Protein Alignment CG42259 and spi-1
DIOPT Version :9
Sequence 1: | NP_001036256.2 |
Gene: | CG42259 / 7354475 |
FlyBaseID: | FBgn0266569 |
Length: | 92 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_872050.1 |
Gene: | spi-1 / 174219 |
WormBaseID: | WBGene00023416 |
Length: | 100 |
Species: | Caenorhabditis elegans |
Alignment Length: | 53 |
Identity: | 18/53 - (33%) |
Similarity: | 27/53 - (50%) |
Gaps: | 5/53 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 CPANETFLACGPDCQTECATLGKPC--LVRHIRCPDGCYCNKGFARNAAGTCI 80
|..||.::.|. .|:.||....:|| :.:..||. |..:||:.|:..|.||
Worm 42 CGLNEVWMVCS-SCEEECGKTPQPCPRICQPARCQ--CPAHKGYRRDGQGNCI 91
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42259 | NP_001036256.2 |
TIL |
30..85 |
CDD:280072 |
18/53 (34%) |
spi-1 | NP_872050.1 |
TIL |
42..91 |
CDD:280072 |
16/51 (31%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1625853at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.