DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42259 and LOC101734536

DIOPT Version :9

Sequence 1:NP_001036256.2 Gene:CG42259 / 7354475 FlyBaseID:FBgn0266569 Length:92 Species:Drosophila melanogaster
Sequence 2:XP_004916465.1 Gene:LOC101734536 / 101734536 -ID:- Length:85 Species:Xenopus tropicalis


Alignment Length:78 Identity:21/78 - (26%)
Similarity:31/78 - (39%) Gaps:9/78 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVFAVSAQIPI----TPRRCPANETFLACGPDCQTECATLGKPCLVRH-IRCPDGCYCNKG--FA 72
            ::..::..:||    ....||..:.|.|||..|...||||.:  |..: ..|...|.|..|  ..
 Frog     5 VILTLALALPIMGKGNDEECPPGKYFDACGRSCPPTCATLDR--LETYGSNCYPSCVCMPGTVLP 67

  Fly    73 RNAAGTCIPLRRC 85
            ...|..|:.:..|
 Frog    68 HEGAEQCVRIAEC 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42259NP_001036256.2 TIL 30..85 CDD:280072 18/57 (32%)
LOC101734536XP_004916465.1 TIL 24..80 CDD:410995 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1625853at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.