DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42259 and LOC100487808

DIOPT Version :9

Sequence 1:NP_001036256.2 Gene:CG42259 / 7354475 FlyBaseID:FBgn0266569 Length:92 Species:Drosophila melanogaster
Sequence 2:XP_002941833.2 Gene:LOC100487808 / 100487808 -ID:- Length:157 Species:Xenopus tropicalis


Alignment Length:83 Identity:22/83 - (26%)
Similarity:36/83 - (43%) Gaps:6/83 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YLFLIGGCCLVFAVSAQIPITPRRCPANETFLACGPDCQTECATLGKPCLVRHIRCPDGCYCNKG 70
            ::|::..|.:..|.:..:...   |||| ::..|...|...|..|.....|..:.|..||.|..|
 Frog    11 FVFVLPVCWVHVAETKSVGTA---CPAN-SYWGCLKTCMESCDKLNDVNPVCPVLCNWGCECKPG 71

  Fly    71 F--ARNAAGTCIPLRRCN 86
            :  ...::..|:||..||
 Frog    72 YILESQSSKVCVPLSDCN 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42259NP_001036256.2 TIL 30..85 CDD:280072 17/56 (30%)
LOC100487808XP_002941833.2 TIL 32..88 CDD:410995 17/56 (30%)
TIL 92..148 CDD:410995
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1625853at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X701
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.