DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and CG42594

DIOPT Version :10

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:NP_001162668.2 Gene:CG42594 / 8674091 FlyBaseID:FBgn0260971 Length:1039 Species:Drosophila melanogaster


Alignment Length:34 Identity:10/34 - (29%)
Similarity:18/34 - (52%) Gaps:3/34 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 CSYIFFVDSVSW--SPTDTVCSRTLSEYVTNLVL 175
            |:|::...:|.:  ...||:| ..|:.|:..|.|
  Fly   273 CAYVYITPNVQYHGMVDDTMC-YDLTIYLKKLAL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:462301
Ion_trans_2 380..453 CDD:462301
CG42594NP_001162668.2 Ion_trans_2 <599..656 CDD:462301
Ion_trans_2 774..846 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.