DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and TOK1

DIOPT Version :9

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:NP_012442.1 Gene:TOK1 / 853352 SGDID:S000003629 Length:691 Species:Saccharomyces cerevisiae


Alignment Length:242 Identity:45/242 - (18%)
Similarity:93/242 - (38%) Gaps:60/242 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 TYASAFLYSLTLITTIGYGGISPRTQWGRVAALVYALFGIPIVLLYLSAMGEALSAGMRCLFRRQ 274
            ||.:|..:....:.|:|.|.|.|::...::..|:::|.|:.::.|.:......:......:|...
Yeast   273 TYGNALYFCTVSLLTVGLGDILPKSVGAKIMVLIFSLSGVVLMGLIVFMTRSIIQKSSGPIFFFH 337

  Fly   275 RVKGGPGGGPGGGASGGVGSGAGGSGGGRKTDKNKGQGHYGHQKLHQYGLPPSVYQQQQAQQAQQ 339
            ||:.|                           ::|...||.....:        ..:::|....:
Yeast   338 RVEKG---------------------------RSKSWKHYMDSSKN--------LSEREAFDLMK 367

  Fly   340 AQQQQAQQAQQAQQQQVQQGKKSSGNRRGSPSVPISICVCVLLCYVSSGAILFHKLQNWSVLESL 404
            ..:|.|.:.|.                    ...:|:.:.:.:.:...||::|...:|||....:
Yeast   368 CIRQTASRKQH--------------------WFSLSVTIAIFMAFWLLGALVFKFAENWSYFNCI 412

  Fly   405 YFCFTSLGTIGFGEMAP-NGAVALYTASAYILVGMAVVAMCFSLIQT 450
            ||||..|.|||:|:.|| .||...:    :::..:..|.:..:::.|
Yeast   413 YFCFLCLLTIGYGDYAPRTGAGRAF----FVIWALGAVPLMGAILST 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301 12/53 (23%)
Ion_trans_2 380..453 CDD:400301 21/72 (29%)
TOK1NP_012442.1 Ion_trans_2 253..328 CDD:400301 12/54 (22%)
Ion_trans_2 388..462 CDD:400301 21/72 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345203
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.