DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and Kcnk9

DIOPT Version :9

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:NP_445857.2 Gene:Kcnk9 / 84429 RGDID:621451 Length:396 Species:Rattus norvegicus


Alignment Length:369 Identity:76/369 - (20%)
Similarity:131/369 - (35%) Gaps:138/369 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 KSHCISATGVLLLVLLYTAMGSIVFVTLEGELEDGGALETAVAASKPYPRTELANAEIRSRTVDR 154
            |...:....::.....|..:|:.||..||.:.|                          .|..::
  Rat     2 KRQNVRTLSLIACTFTYLLVGAAVFDALESDHE--------------------------MREEEK 40

  Fly   155 LWSITEDLNILYKENWTRLAAQEVQLFQDTLLRAVRQSKVYPPGGIQLNAPTHKWTYASAFLYSL 219
            |.:  |::.:..|.|.:....|:::|       .:.||:.: ..|:|       |.:|.:|.:::
  Rat    41 LKA--EEVRLRGKYNISSDDYQQLEL-------VILQSEPH-RAGVQ-------WKFAGSFYFAI 88

  Fly   220 TLITTIGYGGISPRTQWGRVAALVYALFGIPIVLLYLSAMGEALSAGMRCLFRRQRVKGGPGGGP 284
            |:|||||||..:|.|..|:...:.||:.|||:.|:...::||.::..:|.|.:|.          
  Rat    89 TVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRI---------- 143

  Fly   285 GGGASGGVGSGAGGSGGGRKTDKNKGQGHYGHQKLHQYGLPPSVYQQQQAQQAQQAQQQQAQQAQ 349
                                                                             
  Rat   144 ----------------------------------------------------------------- 143

  Fly   350 QAQQQQVQQGKKSSGNRRGSPSVPISICVCVLLCY--VSSGAILFHKLQNWSVLESLYFCFTSLG 412
                      ||..|.|....|:...:.|....|.  :..||..|.:.::||...:.|:||.:|.
  Rat   144 ----------KKCCGMRNTEVSMENMVTVGFFSCMGTLCLGAAAFSQCEDWSFFHAYYYCFITLT 198

  Fly   413 TIGFGE---MAPNGAV---ALYTASA--YILVGMAVVAMCFSLI 448
            |||||:   :...||:   ..|.|.:  |||||:.|:....:|:
  Rat   199 TIGFGDFVALQSKGALQRKPFYVAFSFMYILVGLTVIGAFLNLV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301 22/55 (40%)
Ion_trans_2 380..453 CDD:400301 26/79 (33%)
Kcnk9NP_445857.2 Ion_trans_2 <77..132 CDD:285168 23/61 (38%)
Ion_trans_2 170..243 CDD:285168 25/73 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349030
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.