DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and KCNK16

DIOPT Version :9

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:NP_001128577.1 Gene:KCNK16 / 83795 HGNCID:14464 Length:322 Species:Homo sapiens


Alignment Length:358 Identity:79/358 - (22%)
Similarity:133/358 - (37%) Gaps:148/358 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LCGC---QKAPKSHCISATGVLLLVLLYTAMGSIVFVTLEGELEDGGALETAVAASKPYPRTELA 143
            ||.|   :..|         :||..:.|..:|:.:|..||.:                       
Human     6 LCSCWGGRVLP---------LLLAYVCYLLLGATIFQLLERQ----------------------- 38

  Fly   144 NAEIRSRTVDRLWSITEDLNILYKENWTRL----AAQEVQLFQDTLLRAVRQSKVYPPGGIQLNA 204
             ||.:||...:|    |.|..|  ||:|.|    ..|.||:..:..::.|.      |.|...| 
Human    39 -AEAQSRDQFQL----EKLRFL--ENYTCLDQWAMEQFVQVIMEAWVKGVN------PKGNSTN- 89

  Fly   205 PTHKWTYASAFLYSLTLITTIGYGGISPRTQWGRVAALVYALFGIPIVLLYLSAMGEALSAGMRC 269
            |:: |.:.|:|.::.|::||||||.::|.|:.|:|..:.|||.|||:.:::|:.:|..|.|.:..
Human    90 PSN-WDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALLGIPLNVIFLNHLGTGLRAHLAA 153

  Fly   270 LFRRQRVKGGPGGGPGGGASGGVGSGAGGSGGGRKTDKNKGQGHYGHQKLHQYGLPPSVYQQQQA 334
            :   :|.:..|                      |::           |.|...||          
Human   154 I---ERWEDRP----------------------RRS-----------QVLQVLGL---------- 172

  Fly   335 QQAQQAQQQQAQQAQQAQQQQVQQGKKSSGNRRGSPSVPISICVCVLLCYVSSGAILFHKLQNWS 399
                                                ::.:::...|:|.:   ..::|..::.||
Human   173 ------------------------------------ALFLTLGTLVILIF---PPMVFSHVEGWS 198

  Fly   400 VLESLYFCFTSLGTIGFGE---------MAPNG 423
            ..|..||.|.:|.|||||:         :.|:|
Human   199 FSEGFYFAFITLSTIGFGDYVVGHPLNFITPSG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301 22/55 (40%)
Ion_trans_2 380..453 CDD:400301 17/53 (32%)
KCNK16NP_001128577.1 Ion_trans_2 <92..148 CDD:311712 22/56 (39%)
Ion_trans_2 180..>224 CDD:311712 15/46 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155154
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.