DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and TPK4

DIOPT Version :9

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:NP_171752.1 Gene:TPK4 / 837846 AraportID:AT1G02510 Length:284 Species:Arabidopsis thaliana


Alignment Length:262 Identity:48/262 - (18%)
Similarity:81/262 - (30%) Gaps:100/262 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 KENWTRLAAQEVQLFQDTLLRAVRQSKVYPPGGI--------QLNAPTHKWTYASAFLYSLTLIT 223
            |..||.|....:.|.            ||...|:        |.:. |....:..||.:|:...:
plant    29 KSKWTILVLAMILLL------------VYLTFGVCTYSFFRDQFSG-TETNLFVDAFYFSIVTFS 80

  Fly   224 TIGYGGISPRTQWGRVAALVYALFGIPIVLLYLSAMGEALSAGMRCLFRRQRVKGGPGGGPGGGA 288
            |:|||.|.|.|...::..:|....|: :.|.||  :...:|                        
plant    81 TVGYGDIVPSTSTTKILTIVLVSTGV-VFLDYL--LNRVVS------------------------ 118

  Fly   289 SGGVGSGAGGSGGGRKTDKNKGQGHYGHQKLHQYGLPPSVYQQQQAQQAQQAQQQQA--QQAQQA 351
                                           |...|                 |:.|  .:..:.
plant   119 -------------------------------HVLSL-----------------QENAILDRINKT 135

  Fly   352 QQQQVQQGKKSSGNRRGSPSVPISICVCVLLCYVSSGAILFHKLQNWSVLESLYFCFTSLGTIGF 416
            :.:.::......|..|....:.::.| .|.|| |.|||:..|..:....|:|:|....|:.|:|:
plant   136 RNRAIRDHIAEDGKIRLKWKLCLAFC-AVGLC-VGSGALFLHVFERLDWLDSVYLSVISVTTVGY 198

  Fly   417 GE 418
            |:
plant   199 GD 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301 15/55 (27%)
Ion_trans_2 380..453 CDD:400301 15/39 (38%)
TPK4NP_171752.1 Ion_trans_2 40..118 CDD:285168 21/93 (23%)
Ion_trans_2 169..233 CDD:285168 11/32 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.