DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and KCO1

DIOPT Version :9

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:NP_200374.1 Gene:KCO1 / 835657 AraportID:AT5G55630 Length:363 Species:Arabidopsis thaliana


Alignment Length:102 Identity:25/102 - (24%)
Similarity:53/102 - (51%) Gaps:12/102 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 VCVLLCYVSSGAILFHKLQNW-------SVLESLYFCFTSLGTIGFGEMAPNGAVALYTASAYIL 435
            :..|..|::.|.:.|:.:::.       .|:::||||..::.|:|:|::.||.:.:...|.|::.
plant    80 IMFLALYLTIGTLCFYLVRDQISGHKTSGVVDALYFCIVTMTTVGYGDLVPNSSASRLLACAFVF 144

  Fly   436 VGMAVVAMCFS-----LIQTEIVLWLRRFSVQDHVMP 467
            .||.:|....|     |::.:..|.:|.|.::....|
plant   145 SGMVLVGHLLSRAADYLVEKQEALLVRAFHLRQSFGP 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301
Ion_trans_2 380..453 CDD:400301 21/84 (25%)
KCO1NP_200374.1 Ion_trans_2 81..163 CDD:400301 21/81 (26%)
Ion_trans_2 202..277 CDD:400301
FRQ1 <235..353 CDD:227455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.