DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and KCO2

DIOPT Version :9

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:NP_199449.1 Gene:KCO2 / 834680 AraportID:AT5G46370 Length:443 Species:Arabidopsis thaliana


Alignment Length:151 Identity:36/151 - (23%)
Similarity:70/151 - (46%) Gaps:26/151 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 ISICVCVLLCYVSSGAIL-------FHKLQNWSVLESLYFCFTSLGTIGFGEMAPNGAVALYTAS 431
            ::..|.:|:.|:|.|.::       ::..|...|:::||||..::.|||:|::.|:..|....:.
plant   146 VNQAVALLVVYLSLGVLIYWLNRDSYNVKQTHPVVDALYFCIVTMCTIGYGDITPDSVVTKLFSI 210

  Fly   432 AYILVGMAVVAMCFSLIQTEIVLWLRRFSVQDHVM---PKAEELAL------VTVAVTPKPSXQR 487
            .::|||...:.:..|.:.|.::      .:|::.|   .:.|.|.|      .:..:..|....|
plant   211 FFVLVGFGFMDILLSGMVTYVL------DLQENYMLETARNESLNLNDRDKVRSYIIDVKKGRMR 269

  Fly   488 PSADPSLGVGLGVGLAGGALG 508
                ..|.|||.:|:....||
plant   270 ----IRLKVGLALGVVVLCLG 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301
Ion_trans_2 380..453 CDD:400301 21/79 (27%)
KCO2NP_199449.1 Ion_trans_2 152..233 CDD:400301 21/86 (24%)
Ion_trans_2 280..350 CDD:400301 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.