DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and KCO3

DIOPT Version :9

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:NP_001190480.1 Gene:KCO3 / 834679 AraportID:AT5G46360 Length:260 Species:Arabidopsis thaliana


Alignment Length:159 Identity:32/159 - (20%)
Similarity:56/159 - (35%) Gaps:59/159 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 LPPSVYQQQQAQQAQQAQQQQAQQAQQAQQQQVQQGKKSSGNRRGSPSVPISICVCVLLCYVSSG 388
            :|||::        ...:.........|..|:.:|....|..|:         .:.:|:.|:|.|
plant    34 VPPSLF--------SLPEHNDDTATDMAPDQETEQSVSKSIARQ---------ALALLVVYLSLG 81

  Fly   389 AILFHKLQNWSVLES------------LY-----------------------FCFT--SLGTIGF 416
            .:::     |..|:|            ||                       |||:  .:.|:||
plant    82 VLIY-----WLTLDSDNAYQTHPVAVALYFFVVTFCGFLIVHFVVKIGWLDSFCFSVMMVTTVGF 141

  Fly   417 GEMAPNGAVALYTASAYILVGMAVVAMCF 445
            |:.|.|..:..:.|:.::||....||..|
plant   142 GDRAFNTWLGTFLAAVWLLVSTLAVARAF 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301
Ion_trans_2 380..453 CDD:400301 24/103 (23%)
KCO3NP_001190480.1 Ion_trans_2 104..176 CDD:285168 17/67 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.