DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and KCO5

DIOPT Version :9

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:NP_192093.1 Gene:KCO5 / 828091 AraportID:AT4G01840 Length:408 Species:Arabidopsis thaliana


Alignment Length:290 Identity:61/290 - (21%)
Similarity:105/290 - (36%) Gaps:99/290 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 GIQLNAPTHKWTYASAFLYSLTLITTIGYGGISPRTQWGRVAALVYALFGIPIVLLYLSAM---- 259
            ||:    ||  ....|..:.:..:.|||||.|:|.|.|.::.|:|:.|||...:.:.||.:    
plant   144 GIE----TH--PVVDALYFCIVTMCTIGYGDIAPLTPWTKIFAVVFVLFGFGFLDILLSGVVNYV 202

  Fly   260 ----GEALSAGMRCLFRRQRVKGGPGGGPGGGASGGVGSGAGGSGGGRKTDKNKGQGHYGHQKLH 320
                ...:..|::   .||                                      |:.|...|
plant   203 LDLQESMILTGIQ---TRQ--------------------------------------HHQHHHHH 226

  Fly   321 QYGLPPSVYQQQQAQQAQQAQQQQAQQAQQAQQQQVQQGKKSSGNRRGSPSVPISICVCVLLCYV 385
            ::.....:...::                              |..|....|.:::|| |:|| :
plant   227 RFSAKDYIIDFEK------------------------------GRMRIRMKVCLALCV-VVLC-I 259

  Fly   386 SSGAILFHKLQNWSVLESLYFCFTSLGTIGFGEMAPNGAVALYTASAYILVGMAVVAMCFSLIQT 450
            ..||::.|.::....::|:|....|:.|:|:|:.|.........|:.::||....||..|     
plant   260 GVGALVLHFVEELGFVDSVYLSVMSVTTVGYGDRAFKTLQGRLFAAVWLLVSTLAVARAF----- 319

  Fly   451 EIVLWLRRFSVQDHVMPKAEELAL---VTV 477
               |:|....: |....||.:|||   :||
plant   320 ---LYLAEARI-DRRHRKAVKLALNREITV 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301 17/63 (27%)
Ion_trans_2 380..453 CDD:400301 19/72 (26%)
KCO5NP_192093.1 Ion_trans_2 122..204 CDD:285168 21/65 (32%)
Ion_trans_2 254..325 CDD:285168 22/80 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.