DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and kcnk10b

DIOPT Version :9

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:XP_005169840.1 Gene:kcnk10b / 565629 ZFINID:ZDB-GENE-050420-31 Length:575 Species:Danio rerio


Alignment Length:405 Identity:86/405 - (21%)
Similarity:144/405 - (35%) Gaps:149/405 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 EAGGGGGSLCGCQKAPKSHCISATGVLLLVLLYTAMGSIVFVTLEGELEDGGALETAVAASKPYP 138
            ::|..|.:|....|..     :...|.::||.|...|.:.|..||...|.               
Zfish    80 DSGADGSALHSVMKWK-----TVLAVFVVVLSYLVCGGLAFQALEQPFES--------------- 124

  Fly   139 RTELANAEIRSRTVDRLWSITEDLNILYKENWTRLAAQEVQL--------FQDTLLRAVR--QSK 193
                                      :.|::.|:..||.:|.        .:..:..||.  .:.
Zfish   125 --------------------------IQKDSITQKKAQFLQKNPCVSHADLEALIKHAVEAVSTG 163

  Fly   194 VYPPGGIQLNAPTHKWTYASAFLYSLTLITTIGYGGISPRTQWGRVAALVYALFGIPIVLLYLSA 258
            |.|.|....|  :.:|...|||.::.|:|||||||.|:|.|:.|::..::||:||||:....|:.
Zfish   164 VSPIGDASYN--SSQWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAG 226

  Fly   259 MGEAL-SAGMRCLFRRQRVKGGPGGGPGGGASGGVGSGAGGSGGGRKTDKNKGQGHYGHQKLHQY 322
            :|:.| :..|:.:.|.::                                               
Zfish   227 VGDQLGTMFMKSILRVEK----------------------------------------------- 244

  Fly   323 GLPPSVYQQQQAQQAQQAQQQQAQQAQQAQQQQVQQGKKSSGNRRGSPSVPISICVCVLLCYVSS 387
                 |::|                    :.:|:.|.|     .|.:.::...|..|::  :|:.
Zfish   245 -----VFRQ--------------------KHKQISQTK-----IRVTSTILFIIAGCIV--FVTI 277

  Fly   388 GAILFHKLQNWSVLESLYFCFTSLGTIGFGEMAPNGAVALYTASAY-------ILVGMAVVAMCF 445
            .|:.|...:.||.|:::||...:|.|||.|:....|...:.....|       ||||:|..|...
Zfish   278 PAVFFKHTEGWSTLDAIYFVVITLTTIGIGDYVAGGDRKIEYMKWYKPLVWFWILVGLAYFAAVL 342

  Fly   446 SLIQTEIVLWLRRFS 460
            |:|..    |||..|
Zfish   343 SMIGD----WLRVLS 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301 25/56 (45%)
Ion_trans_2 380..453 CDD:400301 23/79 (29%)
kcnk10bXP_005169840.1 Ion_trans_2 172..231 CDD:285168 25/60 (42%)
Ion_trans_2 271..350 CDD:285168 25/84 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590236
Domainoid 1 1.000 69 1.000 Domainoid score I9562
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.