DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and KCNK9

DIOPT Version :9

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:XP_011515403.1 Gene:KCNK9 / 51305 HGNCID:6283 Length:401 Species:Homo sapiens


Alignment Length:417 Identity:88/417 - (21%)
Similarity:149/417 - (35%) Gaps:152/417 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 KSHCISATGVLLLVLLYTAMGSIVFVTLEGELEDGGALETAVAASKPYPRTELANAEIRSRTVDR 154
            |...:....:::....|..:|:.||..||.:.|                          .|..::
Human     2 KRQNVRTLSLIVCTFTYLLVGAAVFDALESDHE--------------------------MREEEK 40

  Fly   155 LWSITEDLNILYKENWTRLAAQEVQLFQDTLLRAVRQSKVYPPGGIQLNAPTHKWTYASAFLYSL 219
            |.:  |::.|..|.|.:....::::|       .:.||:.: ..|:|       |.:|.:|.:::
Human    41 LKA--EEIRIKGKYNISSEDYRQLEL-------VILQSEPH-RAGVQ-------WKFAGSFYFAI 88

  Fly   220 TLITTIGYGGISPRTQWGRVAALVYALFGIPIVLLYLSAMGEALSAGMRCLFRRQRVKGGPGGGP 284
            |:|||||||..:|.|..|:...:.||:.|||:.|:...::||.::..:|.|.:|.          
Human    89 TVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRI---------- 143

  Fly   285 GGGASGGVGSGAGGSGGGRKTDKNKGQGHYGHQKLHQYGLPPSVYQQQQAQQAQQAQQQQAQQAQ 349
                                                                             
Human   144 ----------------------------------------------------------------- 143

  Fly   350 QAQQQQVQQGKKSSGNRRGSPSVPISICVCVLLCY--VSSGAILFHKLQNWSVLESLYFCFTSLG 412
                      ||..|.|....|:...:.|....|.  :..||..|.:.:.||...:.|:||.:|.
Human   144 ----------KKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLT 198

  Fly   413 TIGFGE---MAPNGAV---ALYTASA--YILVGMAVVAMCFSLIQTEIVLWLRRFSVQDHVMPKA 469
            |||||:   :...||:   .||.|.:  |||||:.|:....:|    :||.....:.:|. ...|
Human   199 TIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLNL----VVLRFLTMNSEDE-RRDA 258

  Fly   470 EELA---------LVTVAVTPKPSXQR 487
            ||.|         ::.:...|:|| .|
Human   259 EERASLAGNRNSMVIHIPEEPRPSRPR 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301 22/55 (40%)
Ion_trans_2 380..453 CDD:400301 27/82 (33%)
KCNK9XP_011515403.1 Ion_trans_2 <77..132 CDD:285168 23/61 (38%)
Ion_trans_2 170..243 CDD:285168 26/76 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155152
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.