DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and kcnk5b

DIOPT Version :9

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:NP_956927.1 Gene:kcnk5b / 393606 ZFINID:ZDB-GENE-040426-1297 Length:448 Species:Danio rerio


Alignment Length:399 Identity:83/399 - (20%)
Similarity:147/399 - (36%) Gaps:143/399 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LVLLYTAMGSIVFVTLEGELEDGGALETAVAASKPYPRTELANAEIRSRTVDRLWSITEDLNILY 166
            :::.|.::|:.:|..||                  .|....|..:.:::|.:.|    :....|.
Zfish    11 VIIFYLSIGAAIFQILE------------------EPNLNSAVDDYKNKTNNLL----KKYPCLS 53

  Fly   167 KENWTRLAAQEVQLFQDTLLRAVRQSKVYPPGGIQLNAPTHKWTYASAFLYSLTLITTIGYGGIS 231
            ||    :..:.:::..:...:.|..:|         .|..:.|.:.:|.:::.|:|||||||.::
Zfish    54 KE----VLGEIIEVVAEATGQGVTVTK---------EAQFNNWNWENAVIFAATVITTIGYGNVA 105

  Fly   232 PRTQWGRVAALVYALFGIPIVLLYLSAMGEALSAGMRCLFRRQRVKGGPGGGPGGGASGGVGSGA 296
            |:|..||:..::|.|.|||:.|.::|.:|....:      |.:|:.                   
Zfish   106 PKTTGGRLFCILYGLCGIPLCLTWISELGTFFGS------RTKRLS------------------- 145

  Fly   297 GGSGGGRKTDKNKGQGHYGHQKLHQYGLPPSVYQQQQAQQAQQAQQQQAQQAQQAQQQQVQQGKK 361
                                |.|...||                           ..::||    
Zfish   146 --------------------QLLLHSGL---------------------------NVRKVQ---- 159

  Fly   362 SSGNRRGSPSVPISICVCV-----LLCYVSSGAILFHKLQNWSVLESLYFCFTSLGTIGFGEMAP 421
                         .||..|     .|.::...|.:|...:||:.||.|||.||:|.|:|||:...
Zfish   160 -------------FICTIVFLLWGFLVHLIIPAFVFMFFENWTYLEGLYFSFTTLTTVGFGDYVA 211

  Fly   422 N-----GAVALYT--ASAYILVGMAVVAMCFS-----LIQTEIVLWLRRFSVQDHVMPKAEELAL 474
            .     ....||.  ...:|.:|:|.:::.||     :::...||..||  ::.|.:|..:....
Zfish   212 GVDPSVNYPTLYRFFVQLWIYLGLAWLSLFFSWNVHMVVEAHKVLKKRR--MRRHRLPTDDVPEK 274

  Fly   475 VTVAVTPKP 483
            ..|..||||
Zfish   275 KEVKKTPKP 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301 22/55 (40%)
Ion_trans_2 380..453 CDD:400301 25/89 (28%)
kcnk5bNP_956927.1 Ion_trans_2 <81..137 CDD:285168 22/55 (40%)
Ion_trans <142..234 CDD:278921 30/174 (17%)
Ion_trans_2 171..243 CDD:285168 22/71 (31%)
C_Hendra 258..>323 CDD:293426 9/28 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590258
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.