DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and KCNQ2

DIOPT Version :9

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:NP_001369164.1 Gene:KCNQ2 / 3785 HGNCID:6296 Length:890 Species:Homo sapiens


Alignment Length:391 Identity:72/391 - (18%)
Similarity:123/391 - (31%) Gaps:150/391 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 LCYVSSGAILF--HKLQN---WSVLESLYFCFTSLGTIGFGEMAP---NGAVALYTASAYILVGM 438
            ||.:.:..:::  .|.:|   .:..::|::...:|.|||:|:..|   ||.:   .|:.:.|:|:
Human   241 LCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYGDKYPQTWNGRL---LAATFTLIGV 302

  Fly   439 AVVAMCFSLIQTEIVLWLRRFSVQDHVMPKAEELALVTVAVTPKPSXQRPSADPSLGVGLGVGLA 503
            :..|:...::.:...|.::....|.|...:                 :.|:|          ||.
Human   303 SFFALPAGILGSGFALKVQEQHRQKHFEKR-----------------RNPAA----------GLI 340

  Fly   504 GGALGQPQNNLGQHQTMFFGPAHTLTQYSSLPRRSHLQAANNSGGGSAFQRNTPIRRSTGIPEHH 568
            ..|......||.:..      .|:..||                    ::|...           
Human   341 QSAWRFYATNLSRTD------LHSTWQY--------------------YERTVT----------- 368

  Fly   569 LEYFVPRSISEFNLSGVGDLALPPPRRYSPNMVGGGGGMGGMGMNMGGMGMNMGMGMGLPHGLQL 633
                ||...|:....|...| :||                   :|...:..|:....||..    
Human   369 ----VPMYSSQTQTYGASRL-IPP-------------------LNQLELLRNLKSKSGLAF---- 405

  Fly   634 GPPQTLLCSAAPTVQQQQQPPPPPAQLQIVTLKPRSEKMVTFEDESKQAVGGGAVGGVAGGSGTP 698
                            ::.|||.|:..|.|:||.|              |.....|..|.|.|:|
Human   406 ----------------RKDPPPEPSPSQKVSLKDR--------------VFSSPRGVAAKGKGSP 440

  Fly   699 --------PHCPHGVPTTPRKSP---AVGD------IFMXPGAQNEAAQVDAAMRLRDSIDDALC 746
                    |.....:..:|.|.|   :.||      .|...||.:.....:|::...|.:||..|
Human   441 QAQTVRRSPSADQSLEDSPSKVPKSWSFGDRSRARQAFRIKGAASRQNSEEASLPGEDIVDDKSC 505

  Fly   747 P 747
            |
Human   506 P 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301
Ion_trans_2 380..453 CDD:400301 17/78 (22%)
KCNQ2NP_001369164.1 Ion_trans 92..324 CDD:395416 18/85 (21%)
KCNQ_channel 448..669 CDD:397540 15/59 (25%)
KCNQ2_u3 684..774 CDD:406935
KCNQC3-Ank-G_bd 786..886 CDD:403240
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.