DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and KCNK2

DIOPT Version :9

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:NP_001017425.2 Gene:KCNK2 / 3776 HGNCID:6277 Length:426 Species:Homo sapiens


Alignment Length:507 Identity:112/507 - (22%)
Similarity:185/507 - (36%) Gaps:186/507 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 VLLLVLLYTAMGSIVFVTLEGELEDGGALETAVAASKPYPRTELANAEIRSRT---VDRLWSITE 160
            :.|:|:||..:|:.||..||                :|:        ||..||   :.:...|::
Human    65 IFLVVVLYLIIGATVFKALE----------------QPH--------EISQRTTIVIQKQTFISQ 105

  Fly   161 DLNILYKENWTRLAAQEVQLFQDTLLRAVRQSKVYPPGGIQLNAPTHKWTYASAFLYSLTLITTI 225
            ...:    |.|.|.    :|.|. ::.|:....:  |.|...|..:| |...|:|.::.|:||||
Human   106 HSCV----NSTELD----ELIQQ-IVAAINAGII--PLGNTSNQISH-WDLGSSFFFAGTVITTI 158

  Fly   226 GYGGISPRTQWGRVAALVYALFGIPIVLLYLSAMGEALSAGMRCLFRRQRVKGGPGGGPGGGASG 290
            |:|.|||||:.|::..::|||.|||:....|:.:|:.|..    :|                   
Human   159 GFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLGT----IF------------------- 200

  Fly   291 GVGSGAGGSGGGRKTDKNKGQGHYGHQKLHQYGLPPSVYQQQQAQQAQQAQQQQAQQAQQAQQQQ 355
              |.|.                                                |:......:..
Human   201 --GKGI------------------------------------------------AKVEDTFIKWN 215

  Fly   356 VQQGKKSSGNRRGSPSVPISICVCVLLCYVSSGAILFHKLQNWSVLESLYFCFTSLGTIGFGEMA 420
            |.|.|     .|...::...:..|||  :|:..||:|..::.||.|:::||...:|.|||||:..
Human   216 VSQTK-----IRIISTIIFILFGCVL--FVALPAIIFKHIEGWSALDAIYFVVITLTTIGFGDYV 273

  Fly   421 PNGAVALY------TASAYILVGMAVVAMCFSLIQTEIVLWLRRFSVQDHVMPKAEELALVTVAV 479
            ..|:...|      ....:||||:|..|...|:|..    |||..|      .|.:|        
Human   274 AGGSDIEYLDFYKPVVWFWILVGLAYFAAVLSMIGD----WLRVIS------KKTKE-------- 320

  Fly   480 TPKPSXQRPSADPSLGVGLGVGLAGGALGQPQNNLGQHQTMFFGPAHTLTQYSSLPRRSHLQAAN 544
                                      .:|:.:.:..:      ..|:...::....||..::..:
Human   321 --------------------------EVGEFRAHAAE------WTANVTAEFKETRRRLSVEIYD 353

  Fly   545 NSGGGSAFQRNTPIRR--STGIPEHHLEYFVP--RSISEFNLSGVGDLALPP 592
            .      |||.|.|:|  |..:..:|.:...|  |::|..:|:...|: |||
Human   354 K------FQRATSIKRKLSAELAGNHNQELTPCRRTLSVNHLTSERDV-LPP 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301 24/55 (44%)
Ion_trans_2 380..453 CDD:400301 27/78 (35%)
KCNK2NP_001017425.2 Ion_trans_2 <142..196 CDD:400301 24/53 (45%)
Ion_trans_2 234..312 CDD:400301 29/83 (35%)
Required for basal channel activity. /evidence=ECO:0000250 354..426 16/52 (31%)
Essential for chloroform and halothane sensitivity. /evidence=ECO:0000250 378..426 8/22 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155160
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.