DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and KCNK1

DIOPT Version :9

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:NP_002236.1 Gene:KCNK1 / 3775 HGNCID:6272 Length:336 Species:Homo sapiens


Alignment Length:418 Identity:90/418 - (21%)
Similarity:146/418 - (34%) Gaps:160/418 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SLCG--CQKAPKSH----CISATGVLLL-VLLYTAMGSIVFVTLEGELEDGGALETAVAASKPYP 138
            ||.|  |.:..:.|    |.   |.|:| .|||...|::||.::|                  .|
Human     4 SLAGSSCVRLVERHRSAWCF---GFLVLGYLLYLVFGAVVFSSVE------------------LP 47

  Fly   139 RTELANAEIRSRTVDRLWSITEDLNILYKENWTRLAAQEVQLFQDTLLRAVRQSKVYPPGGIQL- 202
            ..:|...|:|.            |...:.|....|:.|:::.|...:|.|...       |:.: 
Human    48 YEDLLRQELRK------------LKRRFLEEHECLSEQQLEQFLGRVLEASNY-------GVSVL 93

  Fly   203 -NAPTH-KWTYASAFLYSLTLITTIGYGGISPRTQWGRVAALVYALFGIPIVLLYLSAMGEALSA 265
             ||..: .|.:.||..::.|:::|.|||...|.:..|:...::|::.|||..||:|:|:.:.::.
Human    94 SNASGNWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITV 158

  Fly   266 GMRCLFRRQRVKGGPGGGPGGGASGGVGSGAGGSGGGRKTDKNKGQGHYGHQKLHQYGLPPSVYQ 330
            .:.   ||..:                                     |.|.:   :|....|  
Human   159 HVT---RRPVL-------------------------------------YFHIR---WGFSKQV-- 178

  Fly   331 QQQAQQAQQAQQQQAQQAQQAQQQQVQQGKKSSGNRRGSPSVPISICVCVLL------CYVSSGA 389
                                                       ::|...|||      |:....|
Human   179 -------------------------------------------VAIVHAVLLGFVTVSCFFFIPA 200

  Fly   390 ILFHKLQ-NWSVLESLYFCFTSLGTIGFGEMAPNGAV-----ALYT--ASAYILVG---MAVVAM 443
            .:|..|: :|:.|||.||||.||.|||.|:..|....     .||.  .:.|:|:|   |.||..
Human   201 AVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLE 265

  Fly   444 CFSLIQTEIVLWLRRFSVQDHVMPKAEE 471
            .|..:..     |::|....:|....:|
Human   266 TFCELHE-----LKKFRKMFYVKKDKDE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301 18/55 (33%)
Ion_trans_2 380..453 CDD:400301 31/89 (35%)
KCNK1NP_002236.1 Ion_trans_2 <101..157 CDD:400301 18/55 (33%)
pore-forming domain 107..123 6/15 (40%)
Ion_trans_2 192..267 CDD:400301 27/74 (36%)
pore-forming domain 212..238 14/25 (56%)
Important for intracellular retention in recycling endosomes. /evidence=ECO:0000269|PubMed:19959478 293..299
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155158
Domainoid 1 1.000 57 1.000 Domainoid score I10857
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.