DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and Kcnk12

DIOPT Version :9

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:NP_954859.1 Gene:Kcnk12 / 210741 MGIID:2684043 Length:430 Species:Mus musculus


Alignment Length:440 Identity:93/440 - (21%)
Similarity:161/440 - (36%) Gaps:137/440 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 CGCQKAPKSHCISATG--VLL--LVLLYTAMGSIVFVTLEGELEDGGALETAVAASKPYPRTELA 143
            |.|....:||....||  |||  |:.||...|:.||..||...|                     
Mouse    22 CCCCCCRRSHLNEDTGRFVLLAALIGLYLVAGATVFSALESPGE--------------------- 65

  Fly   144 NAEIRSRTVDRLWSITEDLNILYKENWTR---LAAQEVQLFQDTLLRAVRQSKVYPPGGIQLNAP 205
             ||.|:|     |..|       ..|::.   :|..|::.|       :|..:.....|::.:|.
Mouse    66 -AEARAR-----WGAT-------LRNFSAAHGVAEPELRAF-------LRHYEAALAAGVRADAL 110

  Fly   206 THKWTYASAFLYSLTLITTIGYGGISPRTQWGRVAALVYALFGIPIVLLYLSAMGEALSAGMRCL 270
            ..:|.:..||.:..|:::|||:|..:|.|..|:...:.|.|||....:|:.:...|.:.:.:..:
Mouse   111 RPRWDFPGAFYFVGTVVSTIGFGMTTPATVGGKAFLIAYGLFGCAGTILFFNLFLERIISLLAFI 175

  Fly   271 FRRQRVKGGPGGGPGGGASGGVGSGAGGSGGGRKTDKNKGQGHYGHQKLHQYGLPPSVYQQQQAQ 335
            .|..|                                        .::|.:.||.|:.:::..| 
Mouse   176 MRACR----------------------------------------ERQLRRSGLLPATFRRGSA- 199

  Fly   336 QAQQAQQQQAQQAQQAQQQQVQQGKKSSGNRRGSPSV-----PISICVCVLLCYVSSGAILFHKL 395
                                :.:....:|   ..|||     .:.:...:|.|..|:   ::..:
Mouse   200 --------------------LSEADSLAG---WKPSVYHVLLILGLFAVLLACCASA---MYTSV 238

  Fly   396 QNWSVLESLYFCFTSLGTIGFGEMAPNGAVALYTASAY-------ILVGMAVVAMCFSLIQ---T 450
            :.|..::||||||.:..|||||::..:...|......|       ||:|:..:...|::|.   .
Mouse   239 EGWDYVDSLYFCFVTFSTIGFGDLVSSQHAAYRNQGLYRLGNFLFILLGVCCIYSLFNVISILIK 303

  Fly   451 EIVLW-LRRFSVQ--DHVMPKAEELALVTVAVTPKPSXQRP----SADPS 493
            :::.| ||:.|.:  ....|..........|:||....:|.    .|||:
Mouse   304 QVLNWMLRKLSCRCCTRCCPAPGAPLARRNAITPGSRLRRRLAALGADPA 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301 17/55 (31%)
Ion_trans_2 380..453 CDD:400301 22/82 (27%)
Kcnk12NP_954859.1 Ion_trans_2 101..169 CDD:400301 19/67 (28%)
Ion_trans_2 222..304 CDD:400301 22/84 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845618
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.