DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and twk-6

DIOPT Version :9

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:NP_497973.1 Gene:twk-6 / 192070 WormBaseID:WBGene00006661 Length:347 Species:Caenorhabditis elegans


Alignment Length:222 Identity:42/222 - (18%)
Similarity:75/222 - (33%) Gaps:82/222 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 YASAFLYSLTLITTIGYGGISPRTQWGRVAALVYALFGIPIVLLYLSAMGEALSAGMRCLFRRQR 275
            :..|..:|.||.:|:|||.:.|.:..||...:.|:|..||:.:.:....|..|:..:..:..|.|
 Worm   109 FGKAIFFSWTLYSTVGYGSLYPHSTLGRYLTIFYSLLMIPVFIAFKFEFGTFLAHFLVVVSNRTR 173

  Fly   276 VKGGPGGGPGGGASGGVGSGAGGSGGGRKTDKNKGQGHYGHQKLHQYGLPPSVYQQQQAQQAQQA 340
            :                                                           ..::|
 Worm   174 L-----------------------------------------------------------AVKKA 179

  Fly   341 QQQQAQQAQQAQQQQVQQGKKSSGNRRGSPSVPIS-----ICVCVLLCYVS--SGAILFHKLQNW 398
            ..:.:|..:.|:                :||..:.     ....:|||.:|  |.:.||..::|.
 Worm   180 YYKLSQNPENAE----------------TPSNSLQHDYLIFLSSLLLCSISLLSSSALFSSIENI 228

  Fly   399 SVLESLYFCFTSLGTIGFGEMAPNGAV 425
            |.|.|:||...::..||.|::.|...|
 Worm   229 SYLSSVYFGIITMFLIGIGDIVPTNLV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301 16/52 (31%)
Ion_trans_2 380..453 CDD:400301 18/48 (38%)
twk-6NP_497973.1 Ion_trans_2 <109..163 CDD:285168 17/53 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163793
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.