DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and kvs-4

DIOPT Version :9

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:NP_001367099.1 Gene:kvs-4 / 190011 WormBaseID:WBGene00012967 Length:539 Species:Caenorhabditis elegans


Alignment Length:142 Identity:30/142 - (21%)
Similarity:61/142 - (42%) Gaps:22/142 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 GKKSSGNRRGSPSVPISI-CVCVLLCYVSSGAILFHKLQNW-----------SVLESLYFCFTSL 411
            |:.|||.:....::..|. .:.::...|.:|.|.|..|..:           |:..:.::|..::
 Worm   400 GRYSSGLQMFGKTLKASFRQLGMMAMVVMTGVIFFSTLVYFLEKDEPASKFHSIPAACWWCIVTM 464

  Fly   412 GTIGFGEMAPNGAVALYTASAYILVGMAVVAMCFSLI--------QTEIVLWLRRFSVQDHVMPK 468
            .|:|:|::.|........|:..|..|:.|:|:..::|        :||......|:....:  ||
 Worm   465 TTVGYGDLTPVTVPGKLVATGAIACGVLVLALPITIIVDNFMKVAETERPAGGNRYRTSQY--PK 527

  Fly   469 AEELALVTVAVT 480
            |.:...:.:.||
 Worm   528 ATKSEQMILKVT 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301
Ion_trans_2 380..453 CDD:400301 19/91 (21%)
kvs-4NP_001367099.1 BTB_POZ_Kv 121..208 CDD:349626
Ion_trans 265..513 CDD:395416 23/112 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.