DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and twk-35

DIOPT Version :10

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:NP_508031.3 Gene:twk-35 / 185149 WormBaseID:WBGene00006687 Length:557 Species:Caenorhabditis elegans


Alignment Length:55 Identity:15/55 - (27%)
Similarity:25/55 - (45%) Gaps:7/55 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 SEYVTNLVLVMAIISFSINVSSIVKIVRSAIGLSAVMDQNVSESRKRKRRKMFIQ 221
            |..:..||.|..:|..|:.|.    :.||...:.|.|:   .|.::.|.|..|::
 Worm    12 SNKINPLVPVDLVIDHSVQVD----VARSENAVQANME---LEFQRNKERFAFLK 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:462301 4/14 (29%)
Ion_trans_2 380..453 CDD:462301
twk-35NP_508031.3 Ion_trans_2 230..294 CDD:462301
Ion_trans_2 345..420 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.