DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and C27F2.6

DIOPT Version :9

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:NP_498055.1 Gene:C27F2.6 / 182966 WormBaseID:WBGene00016168 Length:165 Species:Caenorhabditis elegans


Alignment Length:75 Identity:21/75 - (28%)
Similarity:34/75 - (45%) Gaps:2/75 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 VLLCYVS--SGAILFHKLQNWSVLESLYFCFTSLGTIGFGEMAPNGAVALYTASAYILVGMAVVA 442
            :|||.:|  |.:.||..::|.|...|.||.|.::..|.||::.|...|.......:.|:...:..
 Worm    26 LLLCSISLLSSSALFSSIENISYQSSAYFGFMTIFGISFGDIVPTNLVWFSGYCLFFLISDVLSN 90

  Fly   443 MCFSLIQTEI 452
            ..|...|..:
 Worm    91 HIFYFFQARV 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301
Ion_trans_2 380..453 CDD:400301 21/75 (28%)
C27F2.6NP_498055.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.