powered by:
Protein Alignment CG42340 and C27F2.6
DIOPT Version :9
Sequence 1: | NP_001368973.1 |
Gene: | CG42340 / 7354472 |
FlyBaseID: | FBgn0259242 |
Length: | 759 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_498055.1 |
Gene: | C27F2.6 / 182966 |
WormBaseID: | WBGene00016168 |
Length: | 165 |
Species: | Caenorhabditis elegans |
Alignment Length: | 75 |
Identity: | 21/75 - (28%) |
Similarity: | 34/75 - (45%) |
Gaps: | 2/75 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 380 VLLCYVS--SGAILFHKLQNWSVLESLYFCFTSLGTIGFGEMAPNGAVALYTASAYILVGMAVVA 442
:|||.:| |.:.||..::|.|...|.||.|.::..|.||::.|...|.......:.|:...:..
Worm 26 LLLCSISLLSSSALFSSIENISYQSSAYFGFMTIFGISFGDIVPTNLVWFSGYCLFFLISDVLSN 90
Fly 443 MCFSLIQTEI 452
..|...|..:
Worm 91 HIFYFFQARV 100
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42340 | NP_001368973.1 |
Ion_trans_2 |
<208..264 |
CDD:400301 |
|
Ion_trans_2 |
380..453 |
CDD:400301 |
21/75 (28%) |
C27F2.6 | NP_498055.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1418 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.