Sequence 1: | NP_001368973.1 | Gene: | CG42340 / 7354472 | FlyBaseID: | FBgn0259242 | Length: | 759 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001370323.1 | Gene: | B0310.1 / 181922 | WormBaseID: | WBGene00015137 | Length: | 292 | Species: | Caenorhabditis elegans |
Alignment Length: | 195 | Identity: | 48/195 - (24%) |
---|---|---|---|
Similarity: | 83/195 - (42%) | Gaps: | 48/195 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 GCQKAPK-----SHCISATGVLLLVLLYTAMGSIVFVTLEGELEDGGALETAVAASKPYPRTELA 143
Fly 144 NAEI------RSRTVDRLW--SITEDLNILYKENWTRLAAQEVQLFQDTLLRAVRQSKVYPPGGI 200
Fly 201 QLNAPTHKWTYASAFLYSLTLITTIGYGGISPRTQWGRVAALVYALFGIPIVLLYLSAMGEALSA 265
Fly 266 265 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42340 | NP_001368973.1 | Ion_trans_2 | <208..264 | CDD:400301 | 17/55 (31%) |
Ion_trans_2 | 380..453 | CDD:400301 | |||
B0310.1 | NP_001370323.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |