DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and B0310.1

DIOPT Version :9

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:NP_001370323.1 Gene:B0310.1 / 181922 WormBaseID:WBGene00015137 Length:292 Species:Caenorhabditis elegans


Alignment Length:195 Identity:48/195 - (24%)
Similarity:83/195 - (42%) Gaps:48/195 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 GCQKAPK-----SHCISATGVLLLVLLYTAMGSIVFVTLEGELEDGGALETAVAASKPYPRTELA 143
            |....||     ..|:..|.||:..|.   :|.|:|..|                ..|..:.:..
 Worm     2 GADLPPKFQYAFRRCLFYTFVLVAWLF---IGMILFPAL----------------CTPAVKQDDN 47

  Fly   144 NAEI------RSRTVDRLW--SITEDLNILYKENWTRLAAQEVQLFQDTLLRAVRQSKVYPPGGI 200
            .|.|      ||..::.||  :||..     :::|:.||.|:::|::..||:..         ||
 Worm    48 EAGIFRLDAKRSDLLNVLWAETITNG-----EDDWSELADQKLELYEKALLQHY---------GI 98

  Fly   201 QLNAPTHKWTYASAFLYSLTLITTIGYGGISPRTQWGRVAALVYALFGIPIVLLYLSAMGEALSA 265
            .|:....  ::||....|..:.||||...:...|..|::.|::|||.|.|:.|..:..:|:.:::
 Worm    99 DLDKSDK--SFASGLQKSFAISTTIGPLDVDDFTTLGKLIAVLYALIGTPLFLTVIGQLGKMVTS 161

  Fly   266  265
             Worm   162  161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301 17/55 (31%)
Ion_trans_2 380..453 CDD:400301
B0310.1NP_001370323.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.