DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and KCNK7

DIOPT Version :9

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:NP_203133.1 Gene:KCNK7 / 10089 HGNCID:6282 Length:307 Species:Homo sapiens


Alignment Length:453 Identity:99/453 - (21%)
Similarity:140/453 - (30%) Gaps:212/453 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 SATGVLLLV-LLYTAMGSIVFVTLEGELEDGGALETAVAASKPYPRTELANAEIRSRTVDRLWSI 158
            |..|:|::. ||...:|::||..|||.                 |...| .||:|:         
Human     8 SRYGLLVVAHLLALGLGAVVFQALEGP-----------------PACRL-QAELRA--------- 45

  Fly   159 TEDLNILYKENWTRLAAQEVQLFQDTLLRAVRQSKVYPPG------GIQLNAPTH---------- 207
                              |:..||      .......|||      |..|....|          
Human    46 ------------------ELAAFQ------AEHRACLPPGALEELLGTALATQAHGVSTLGNSSE 86

  Fly   208 --KWTYASAFLYSLTLITTIGYGGISPRTQWGRVAALVYALFGIPIVLLYLSAMGEALSAGMR-C 269
              .|...||.|::.:::||.|||.::|.:..|:...:|||..|:|..|        ||.|.:| |
Human    87 GRTWDLPSALLFAASILTTTGYGHMAPLSPGGKAFCMVYAALGLPASL--------ALVATLRHC 143

  Fly   270 LFRRQRVKGGPGGGPGGGASGGVGSGAGGSGGGRKTDKNKGQGHYGHQKLHQYGLPPSVYQQQQA 334
            |                                                     ||     ....
Human   144 L-----------------------------------------------------LP-----VLSR 150

  Fly   335 QQAQQAQQQQAQQAQQAQQQQVQQGKKSSGNRRGSPSVPISICVCVLLCYVSSGAILFHKLQNW- 398
            .:|..|...|...|:.|..|.|..|                     ||  |:|..:|...|..| 
Human   151 PRAWVAVHWQLSPARAALLQAVALG---------------------LL--VASSFVLLPALVLWG 192

  Fly   399 -----SVLESLYFCFTSLGTIGFGEMAPN------------GAVALYTASAYILVGMAVVAMCFS 446
                 |:|.::||||:||.|||..::.|.            |.:||.   .|:|:|:  :||   
Human   193 LQGDCSLLGAVYFCFSSLSTIGLEDLLPGRGRSLHPVIYHLGQLALL---GYLLLGL--LAM--- 249

  Fly   447 LIQTEIVLWLRRFS--VQDHVMPK------------------AEELALVTVAVTPKPSXQRPS 489
                  :|.:..||  .|...|.|                  .:||||.|:......|.|.|:
Human   250 ------LLAVETFSELPQVRAMGKFFRPSGPVTAEDQGGILGQDELALSTLPPAAPASGQAPA 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301 18/55 (33%)
Ion_trans_2 380..453 CDD:400301 27/90 (30%)
KCNK7NP_203133.1 Ion_trans_2 <90..140 CDD:285168 20/57 (35%)
Ion_trans_2 182..>220 CDD:285168 14/37 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155150
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.