DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42340 and XB5727110

DIOPT Version :9

Sequence 1:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster
Sequence 2:XP_031747981.1 Gene:XB5727110 / 100486031 XenbaseID:XB-GENE-5727111 Length:318 Species:Xenopus tropicalis


Alignment Length:400 Identity:85/400 - (21%)
Similarity:158/400 - (39%) Gaps:132/400 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 PKSHCISATGVLLLVLLYTAMGSIVFVTLEGELEDGGALETAVAASKPYPRTELANAEIRSRTVD 153
            |.:..:.:..:.:..::|..:|::||..||.|.||     ||        :|:            
 Frog     2 PSAEILKSILLAMAFMVYLLVGALVFQVLEKEAED-----TA--------KTD------------ 41

  Fly   154 RLWSITEDLNILYKENWTRLAAQEVQLFQDTLLRAVRQSKVYPPGGIQLNAPTHKWTYASAFLYS 218
                 ||...:.:.:|:|.|..:.:....:.:..||:|. ::|......|:.:: |..:|:|.::
 Frog    42 -----TERHRLDFLKNYTCLTKEALDHLVNVITDAVKQG-IHPLENQTKNSHSN-WDMSSSFFFA 99

  Fly   219 LTLITTIGYGGISPRTQWGRVAALVYALFGIPIVLLYLSAMGEALSAGMRCLFRRQRVKGGPGGG 283
            .|::||||||.:||||..|::..::|||||||:.::.|..:|:.||.....|             
 Frog   100 GTVVTTIGYGTLSPRTPGGQIFCVLYALFGIPLNVIVLGRVGKILSRVCHRL------------- 151

  Fly   284 PGGGASGGVGSGAGGSGGGRKTDKNKGQGHYGHQKLHQYGLPPSVYQQQQAQQAQQAQQQQAQQA 348
                                        |.|...|    |:.|                      
 Frog   152 ----------------------------GQYFFNK----GMKP---------------------- 162

  Fly   349 QQAQQQQVQQGKKSSGNRRGSPSVPISICVCVLLCYVSSGAILFHKLQNWSVLESLYFCFTSLGT 413
                             ::......|...|..::.::....:||.|.:.|:..|.:|:.|.||.|
 Frog   163 -----------------KKAKVLTIIFFSVTGIIVFLGLPPLLFTKTEKWTYTEGVYYAFISLST 210

  Fly   414 IGFGE----------MAPNGAVALYTASAYILVGMAVVAMCFSLIQTEIVLWLRRFS--VQDHVM 466
            ||||:          |...|..||  ...:|:.|::.:::.|:|:.:.:....::.:  :|..|.
 Frog   211 IGFGDYVVGYGPQHFMPFRGFRAL--VCLWIIFGLSWLSLLFNLLTSLLEDTEKKIAKDIQKKVK 273

  Fly   467 PK--AEELAL 474
            .|  :|::||
 Frog   274 SKKDSEQIAL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301 24/55 (44%)
Ion_trans_2 380..453 CDD:400301 22/82 (27%)
XB5727110XP_031747981.1 Ion_trans_2 86..146 CDD:400301 25/60 (42%)
Ion_trans_2 178..245 CDD:400301 20/68 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.