DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42342 and Colec11

DIOPT Version :9

Sequence 1:NP_001189234.1 Gene:CG42342 / 7354466 FlyBaseID:FBgn0259244 Length:831 Species:Drosophila melanogaster
Sequence 2:NP_001300907.1 Gene:Colec11 / 71693 MGIID:1918943 Length:278 Species:Mus musculus


Alignment Length:130 Identity:47/130 - (36%)
Similarity:58/130 - (44%) Gaps:30/130 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 VKDLQEAGVNVSASTVIKL-KGEPGE------------PGPPGPPGEAGQPGAPGERGPPGEIGA 378
            ::||..||:.:|.:.:..| .|.|.:            ||..|..||.|..||||..|..|..|.
Mouse     3 MRDLALAGMLISLAFLSLLPSGCPQQTTEDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGE 67

  Fly   379 QGPQGEAGQPGVAGPPGVAGAPGTKGDKGDRGDRGLTTTIKGDEFPTGIIEGPPGPAGPPGPPGE 443
            :|..|:.||.|..|..|..|..|.||:|||.||                 .|||||:|.||.|.|
Mouse    68 KGDMGDKGQKGTVGRHGKIGPIGAKGEKGDSGD-----------------IGPPGPSGEPGIPCE 115

  Fly   444  443
            Mouse   116  115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42342NP_001189234.1 DUF4763 130..>210 CDD:292582
Collagen 366..413 CDD:189968 22/46 (48%)
Collagen 660..718 CDD:189968
Collagen 690..748 CDD:189968
Colec11NP_001300907.1 Collagen 41..96 CDD:189968 24/54 (44%)
CLECT_collectin_like 158..273 CDD:153061
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.