powered by:
Protein Alignment CG42342 and colec11
DIOPT Version :9
Sequence 1: | NP_001189234.1 |
Gene: | CG42342 / 7354466 |
FlyBaseID: | FBgn0259244 |
Length: | 831 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_009291466.1 |
Gene: | colec11 / 492459 |
ZFINID: | ZDB-GENE-041114-11 |
Length: | 277 |
Species: | Danio rerio |
Alignment Length: | 72 |
Identity: | 38/72 - (52%) |
Similarity: | 43/72 - (59%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 506 GRDGRDGSKGEPGEPGEPGSLGPRGLDGLPGEPGIEGPPGLPGYQGPPGEKGDRGDIGPPGLMGP 570
|..|..|.|||.|.||.||.:||.|..|.||:.|.:|.||..|..||.|.||.:||:|.||..||
Zfish 41 GLKGEAGEKGEKGAPGRPGRVGPSGEQGPPGDKGQKGSPGRYGKMGPTGPKGLKGDMGDPGPKGP 105
Fly 571 PGLPGPP 577
.|.||.|
Zfish 106 NGEPGVP 112
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.