DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42395 and AT2G04900

DIOPT Version :9

Sequence 1:NP_001138182.3 Gene:CG42395 / 7354436 FlyBaseID:FBgn0259741 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_565317.1 Gene:AT2G04900 / 815037 AraportID:AT2G04900 Length:128 Species:Arabidopsis thaliana


Alignment Length:111 Identity:33/111 - (29%)
Similarity:58/111 - (52%) Gaps:11/111 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 RLAGIGGASAIFMSAYCKYVLRDIESIREQLDSQAFADV---ANRIHFLHSFALMAMPLAHYPFL 132
            ::|.|.|.:|:.:..|..:|.:.        ::.::..|   |:..|.:|:.||::.|...||.:
plant    25 KVAAISGMAALGLGTYGAHVFKP--------ENPSYKQVWQTASLYHLVHTAALVSAPSTKYPNI 81

  Fly   133 TGTLMITGTLAFSGSMYYRALTGEKWMQPYATMGGFCLMAAWLSLV 178
            .|.|:..|.:||||:.|..||..::.....|..|||..:|||.:|:
plant    82 FGGLLTAGIVAFSGTCYMVALREDRKFSTLAPFGGFAFIAAWATLL 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42395NP_001138182.3 DUF423 83..168 CDD:282144 23/87 (26%)
AT2G04900NP_565317.1 DUF423 37..116 CDD:398086 22/86 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 44 1.000 Domainoid score I4692
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2534
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1632823at2759
OrthoFinder 1 1.000 - - FOG0005087
OrthoInspector 1 1.000 - - otm3199
orthoMCL 1 0.900 - - OOG6_102451
Panther 1 1.100 - - LDO PTHR43461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.