DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42395 and CG12289

DIOPT Version :9

Sequence 1:NP_001138182.3 Gene:CG42395 / 7354436 FlyBaseID:FBgn0259741 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_648465.2 Gene:CG12289 / 39279 FlyBaseID:FBgn0036160 Length:378 Species:Drosophila melanogaster


Alignment Length:106 Identity:24/106 - (22%)
Similarity:31/106 - (29%) Gaps:41/106 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 ESIREQLDSQAFADVANRI----HFLHSFA----LMAMPLAHYPFLTGTLMITGTLAFSGSMYYR 151
            :.||..||.....|..:||    ...:||.    |:||  ..|.|:|              .|..
  Fly   154 DMIRLILDHNNGRDERDRIVVSLQIFNSFEQVVHLIAM--CDYVFVT--------------KYIA 202

  Fly   152 ALTGEKWMQPYATMGGF---------------CLMAAWLSL 177
            ...|  |..|.....|.               |::..|.||
  Fly   203 ESRG--WKSPLEACEGVNALLRMPRNIRIRRPCIIVPWSSL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42395NP_001138182.3 DUF423 83..168 CDD:282144 19/80 (24%)
CG12289NP_648465.2 Ketohexokinase 12..309 CDD:238914 24/106 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456436
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.