DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42395 and CG13369

DIOPT Version :10

Sequence 1:NP_001138182.3 Gene:CG42395 / 7354436 FlyBaseID:FBgn0259741 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_569850.1 Gene:CG13369 / 31007 FlyBaseID:FBgn0025640 Length:304 Species:Drosophila melanogaster


Alignment Length:136 Identity:29/136 - (21%)
Similarity:53/136 - (38%) Gaps:35/136 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAETLHYLILRNPSSQIVIASANAVLESIGLENWKIPVDDSIVSLPPSAQSYVHSHSSLYCL--A 63
            ||:|        |...:.:||...|.||          :.::::..|...:..|:..::..|  |
  Fly   167 MADT--------PPELLQLASIFCVNES----------EAALMTQMPDIGNIEHAEDAVGKLIAA 213

  Fly    64 GCHYHFMRLAGIGGASAIFMSA----YCKYVLRDIESIREQLDSQAFADVANRIHFLHSFALMAM 124
            |.:...:.|..:|   |:|.||    .|::|........:.:|:....|.     |:   ..:|.
  Fly   214 GANTVIITLGKLG---AVFGSADSKGVCQHVAAPSVPPEKVVDTTGAGDA-----FI---GALAH 267

  Fly   125 PLAHYP 130
            .||.:|
  Fly   268 NLARHP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42395NP_001138182.3 DUF423 <108..167 CDD:461234 6/23 (26%)
CG13369NP_569850.1 ribokinase 6..303 CDD:238579 29/136 (21%)

Return to query results.
Submit another query.