DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42395 and Tmem256

DIOPT Version :9

Sequence 1:NP_001138182.3 Gene:CG42395 / 7354436 FlyBaseID:FBgn0259741 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001164020.1 Gene:Tmem256 / 287442 RGDID:1563438 Length:113 Species:Rattus norvegicus


Alignment Length:116 Identity:40/116 - (34%)
Similarity:63/116 - (54%) Gaps:5/116 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LAGCHYHFMRLAGIGGASAIFMSAYCKYVLRDIESIREQLDSQAFADVANRIHFLHSFALMAMPL 126
            :||....|.||..:.||.|:.::.|..:..:..::..::|     .|.||:.|||||.||:.:|.
  Rat     1 MAGVGAAFRRLGALSGAGALSLATYGAHGAQFPDAYGKEL-----FDKANKHHFLHSLALLGVPY 60

  Fly   127 AHYPFLTGTLMITGTLAFSGSMYYRALTGEKWMQPYATMGGFCLMAAWLSL 177
            ...|...|.|:.:||..|..|.||:||:|:..:|....:||..|:..||:|
  Rat    61 CRKPVWAGLLLASGTTLFCTSFYYQALSGDTSIQTLGPVGGSLLILGWLAL 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42395NP_001138182.3 DUF423 83..168 CDD:282144 27/84 (32%)
Tmem256NP_001164020.1 DUF423 22..101 CDD:398086 26/83 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353553
Domainoid 1 1.000 58 1.000 Domainoid score I10518
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5191
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1632823at2759
OrthoFinder 1 1.000 - - FOG0005087
OrthoInspector 1 1.000 - - otm44975
orthoMCL 1 0.900 - - OOG6_102451
Panther 1 1.100 - - LDO PTHR43461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.