DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42395 and SPAC1782.12c

DIOPT Version :9

Sequence 1:NP_001138182.3 Gene:CG42395 / 7354436 FlyBaseID:FBgn0259741 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001342948.1 Gene:SPAC1782.12c / 2542361 PomBaseID:SPAC1782.12c Length:118 Species:Schizosaccharomyces pombe


Alignment Length:118 Identity:28/118 - (23%)
Similarity:60/118 - (50%) Gaps:15/118 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LAGIGGASAIFMSAYCKYVLRDIESIREQLDSQAFADVANRIHFLHSFALMAMPLAHYPFL---- 132
            :|.:.|..::.:.||..:.|:  :.:::....::::.....:.| ||.|.||:.|  :|..    
pombe     6 VAALTGLLSVGLGAYGSHGLQ--KRVQDPHLLKSWSTACTYLMF-HSLATMAVSL--HPVYGKSR 65

  Fly   133 -TGTLMITGTLAFSGSMYYRALTGE-----KWMQPYATMGGFCLMAAWLSLVL 179
             ||.|:|||:..|||::|...|..:     :.:.|...:||..::..|.::::
pombe    66 WTGPLLITGSCLFSGTIYGLCLLPKGHSLRRILGPLTPIGGLVMLTGWATMLV 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42395NP_001138182.3 DUF423 83..168 CDD:282144 24/94 (26%)
SPAC1782.12cNP_001342948.1 YgdD 1..118 CDD:225238 28/116 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2079
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005087
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102451
Panther 1 1.100 - - LDO PTHR43461
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4384
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.990

Return to query results.
Submit another query.