DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42302 and TIM8

DIOPT Version :10

Sequence 1:NP_001097022.2 Gene:CG42302 / 7354435 FlyBaseID:FBgn0259198 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_058168.1 Gene:TIM8 / 853600 SGDID:S000007348 Length:87 Species:Saccharomyces cerevisiae


Alignment Length:49 Identity:17/49 - (34%)
Similarity:32/49 - (65%) Gaps:2/49 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IQELIKKMTRRCFDVCI-AMPEMELRSTERDCLANCMDRFMD-SVQVVS 66
            :|..|.:.|..||..|: ::.:..|.|.|..||:||::||:| ::::|:
Yeast    33 VQMSIHQFTNICFKKCVESVNDSNLSSQEEQCLSNCVNRFLDTNIRIVN 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42302NP_001097022.2 zf-Tim10_DDP 11..69 CDD:460764 17/49 (35%)
TIM8NP_058168.1 zf-Tim10_DDP 23..85 CDD:460764 17/49 (35%)

Return to query results.
Submit another query.