DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42302 and timm8b

DIOPT Version :10

Sequence 1:NP_001097022.2 Gene:CG42302 / 7354435 FlyBaseID:FBgn0259198 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001017099.1 Gene:timm8b / 549853 XenbaseID:XB-GENE-1010040 Length:94 Species:Xenopus tropicalis


Alignment Length:39 Identity:14/39 - (35%)
Similarity:26/39 - (66%) Gaps:0/39 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CFDVCIAMPEMELRSTERDCLANCMDRFMDSVQVVSSQY 69
            |:|.|:..|..:|.|...:||.:|:|||:|:...|::::
 Frog    47 CWDKCMDRPGNKLDSRTENCLVSCVDRFIDTTLSVTNRF 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42302NP_001097022.2 zf-Tim10_DDP 11..69 CDD:460764 14/37 (38%)
timm8bNP_001017099.1 zf-Tim10_DDP 25..87 CDD:460764 14/39 (36%)

Return to query results.
Submit another query.