DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42302 and Tim8

DIOPT Version :10

Sequence 1:NP_001097022.2 Gene:CG42302 / 7354435 FlyBaseID:FBgn0259198 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_572713.1 Gene:Tim8 / 32081 FlyBaseID:FBgn0027359 Length:88 Species:Drosophila melanogaster


Alignment Length:72 Identity:20/72 - (27%)
Similarity:38/72 - (52%) Gaps:5/72 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATNQHDLER---IRQQIVLANIQELIKKMTRRCFDVCIAMPEMELRSTERDCLANCMDRFMDSV 62
            ::.|..:|:.   |.:|....|.|  |.:....|::.||..|..:|......||:||:|||:|:.
  Fly     7 LSGNDKELQEFLLIEKQKAQVNAQ--IHEFNEICWEKCIGKPSTKLDHATETCLSNCVDRFIDTS 69

  Fly    63 QVVSSQY 69
            .:::.::
  Fly    70 LLITQRF 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42302NP_001097022.2 zf-Tim10_DDP 11..69 CDD:460764 18/57 (32%)
Tim8NP_572713.1 zf-Tim10_DDP 16..78 CDD:460764 18/63 (29%)

Return to query results.
Submit another query.