DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42302 and TIMM13

DIOPT Version :10

Sequence 1:NP_001097022.2 Gene:CG42302 / 7354435 FlyBaseID:FBgn0259198 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_036590.1 Gene:TIMM13 / 26517 HGNCID:11816 Length:95 Species:Homo sapiens


Alignment Length:70 Identity:30/70 - (42%)
Similarity:47/70 - (67%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LERIRQQIVLANIQELIKKMTRRCFDVCIAMPEMELRSTERDCLANCMDRFMDSVQVVSSQYFRR 72
            :|:::.||.:||.|||:::||.:||..||..|...|.::|:.|:|.||||:||:...||..|..|
Human    23 MEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSR 87

  Fly    73 RRRHQ 77
            .:|.:
Human    88 LQRER 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42302NP_001097022.2 zf-Tim10_DDP 11..69 CDD:460764 26/57 (46%)
TIMM13NP_036590.1 zf-Tim10_DDP 24..86 CDD:460764 28/61 (46%)
Twin CX3C motif 46..69 9/22 (41%)

Return to query results.
Submit another query.