DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OtopLc and OTOP3

DIOPT Version :9

Sequence 1:NP_001303575.1 Gene:OtopLc / 7354434 FlyBaseID:FBgn0259150 Length:1596 Species:Drosophila melanogaster
Sequence 2:NP_839947.1 Gene:OTOP3 / 347741 HGNCID:19658 Length:596 Species:Homo sapiens


Alignment Length:620 Identity:130/620 - (20%)
Similarity:234/620 - (37%) Gaps:173/620 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   887 KAGDALATLFSALYGKLLVVMGIAFPMAEVISTYIPPSFYEVYYLY--LYIGSMIFLLFMYATLI 949
            |||.    |||.|....:|.:|.|| :..:|...:..:..:|:.|.  |.:.|:::||:..|:  
Human    85 KAGQ----LFSGLLALNVVFLGGAF-ICSMIFNKVAVTLGDVWILLATLKVLSLLWLLYYVAS-- 142

  Fly   950 WGRPKLPVPIASPSKSATKASGTDSMDESDTDSNSVHHRLPPPIPVRRPSLLSPLGRRDAHYGSF 1014
                                                        ..|||..:.   .:|.|.|..
Human   143 --------------------------------------------TTRRPHAVL---YQDPHAGPL 160

  Fly  1015 YLRMGAVAFGIGSMIYSGLEFGQYFELNPDTKCHNVLLALTPATRMAFIFIQMYFIFLN-NEQIK 1078
            ::|...|.||..:...:....|  :::: ..:|.:.|..:.....|.||.:|.:.::.: .:.::
Human   161 WVRGSLVLFGSCTFCLNIFRVG--YDVS-HIRCKSQLDLVFSVIEMVFIGVQTWVLWKHCKDCVR 222

  Fly  1079 VYRYKIIARFGLMHMIGTNLAVWLNVLIQETKHE-------ILTFYNPENRTLRISHRIPGHSRG 1136
            |...  ..|.|||..:.|||.:|:..:..::.|.       ||...:..|.|             
Human   223 VQTN--FTRCGLMLTLATNLLLWVLAVTNDSMHREIEAELGILMEKSTGNET------------- 272

  Fly  1137 HAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWRS 1201
            :..:..:.||.....||..                       .|:|.:.||.|||.|:|:|||::
Human   273 NTCLCLNATACEAFRRGFL-----------------------MLYPFSTEYCLICCAVLFVMWKN 314

  Fly  1202 ISRPQTPTPQRPDMISSPMKRSPHHYSVDCARAHKGLF---VGILILVLTIISLIIFFVLISRPE 1263
            :.|...     |.|.:.| ..:|.|       .|..:|   :|:|:|:..:...::|.:..|.|.
Human   315 VGRHVA-----PHMGAHP-ATAPFH-------LHGAIFGPLLGLLVLLAGVCVFVLFQIEASGPA 366

  Fly  1264 FVAMAVTEVTICELLIYGTATIATLVGM----IQIRHLQYDAYRSFSLDDILLVGAQTGSFLYNI 1324
            ......|......:.:..|.::|.|.|.    ::.|.|......:.|||.:||:||..|......
Human   367 IACQYFTLYYAFYVAVLPTMSLACLAGTAIHGLEERELDTVKNPTRSLDVVLLMGAALGQMGIAY 431

  Fly  1325 FTVIA-----GHFTLRSDDMLVPINALASIVQTACQTMFILD---------------ASRRQAVS 1369
            |:::|     .|..|   :.|:...:|..|:|...|.:||::               |.:::|..
Human   432 FSIVAIVAKRPHELL---NRLILAYSLLLILQHIAQNLFIIEGLHRRPLWETVPEGLAGKQEAEP 493

  Fly  1370 P-----------------------EHL--RKKPGREIVTFMLVVNLAMWAISTLEKSRAESHPIQ 1409
            |                       .||  :::..:||..|:::.|:.:|.:..........:.::
Human   494 PRRGSLLELGQGLQRASLAYIHSYSHLNWKRRALKEISLFLILCNITLWMMPAFGIHPEFENGLE 558

  Fly  1410 LNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIW 1444
            .:|||...|..|.:..:||.:|||.||...|.|::
Human   559 KDFYGYQIWFAIVNFGLPLGVFYRMHSVGGLVEVY 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OtopLcNP_001303575.1 Otopetrin 1015..1434 CDD:281218 100/478 (21%)
OTOP3NP_839947.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..59
Otopetrin 162..582 CDD:281218 99/476 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4740
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243107at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8528
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21522
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X278
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.